PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g024640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 506aa    MW: 58642.7 Da    PI: 4.6357
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g024640.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3368.41.3e-112333631310
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX..........XXXXXXX...........XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa.........tgakksn...........ksneqarrkkmsraQDgiLkYMlkemevcnaqGfv 73 
                       ++lk+rmwkd+ml++  k +k++ + + +a+               +             +eq+rrkkmsraQD++LkYM+k+me+c+ qGfv
  Sopen04g024640.1  33 DDLKRRMWKDRMLMQIFKANKRDMIINTSASsseelsldqD-----EdeeeeedeesqAKQEQSRRKKMSRAQDSVLKYMVKIMEICKGQGFV 120
                       79*************99999999776666555555555540.....04455566666699********************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT CS
              EIN3  74 YgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplek 166
                       Ygi+pekgkpv+g+sdsLr+WWk+kv+f++n+p+ai+     +l+  +e+ l   ++s    l++lqDTtlgSLLs+lmqhc ppqrrfpl+k
  Sopen04g024640.1 121 YGIVPEKGKPVTGSSDSLREWWKDKVRFEKNAPNAIAAF-LPELV--EENVL--VPNSCMDLLNDLQDTTLGSLLSSLMQHCIPPQRRFPLDK 208
                       *************************************99.44666..33444..48899999******************************* PP

                       --HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S-- CS
              EIN3 167 gvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecat 259
                       g++pPWWPtG+elwwg +g+s++qg+ppykkphdlkkawkvsvL+  ikhms +++++r+l+ qsk+lq+km+ake++++++v+nqee +++ 
  Sopen04g024640.1 209 GLAPPWWPTGTELWWGDQGFSQEQGPPPYKKPHDLKKAWKVSVLAGIIKHMSVNFDKMRRLVKQSKSLQNKMTAKETATWSKVVNQEEVLIKM 301
                       ****************************************************************************************98854 PP

                       XXXXXX..XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX...............XXXXXXXX CS
              EIN3 260 vsahss..slrkqspkvtlsceqkedvegkkeskikhvqavktta...............gfpvvrkr 310
                            +  ++++++++ +l  + +e ++g  es i +       +               gfp  + r
  Sopen04g024640.1 302 TEKALKisTSKEEDQENVLALRRNEKRKGVFESDIDTE------DmlyqnlncaqselgvGFPYKNSR 363
                       44442222222233333333333333332222222221......123333344555564433333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.2E-11233296No hitNo description
Gene3DG3DSA:1.10.3180.101.6E-64173302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.76E-57176299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MVEFEEIIEP LSPINSELVE ENKDIDDEEI NYDDLKRRMW KDRMLMQIFK ANKRDMIINT  60
SASSSEELSL DQDEDEEEEE DEESQAKQEQ SRRKKMSRAQ DSVLKYMVKI MEICKGQGFV  120
YGIVPEKGKP VTGSSDSLRE WWKDKVRFEK NAPNAIAAFL PELVEENVLV PNSCMDLLND  180
LQDTTLGSLL SSLMQHCIPP QRRFPLDKGL APPWWPTGTE LWWGDQGFSQ EQGPPPYKKP  240
HDLKKAWKVS VLAGIIKHMS VNFDKMRRLV KQSKSLQNKM TAKETATWSK VVNQEEVLIK  300
MTEKALKIST SKEEDQENVL ALRRNEKRKG VFESDIDTED MLYQNLNCAQ SELGVGFPYK  360
NSRMDNETTC FYRGKQTMNE QQSVNDKGED ESLNMFMNNF TSLIGTQPIP HKEIMVGDDH  420
HSEHDGMNMD IKRSVDNYHI AQYANRRSIE ENFEGFWGDN NVLEQLHYDN IMNLNDTPKE  480
NEHHHSPLSV WDLAYEDTSE QSSSYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-551783006128Protein ETHYLENE INSENSITIVE 3
4zds_B1e-551783006128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1322328RRNEKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072728.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLK4BSN20.0K4BSN2_SOLLC; Uncharacterized protein
STRINGSolyc04g054840.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-123EIL family protein